DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and ceh-51

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_507685.1 Gene:ceh-51 / 180233 WormBaseID:WBGene00013583 Length:234 Species:Caenorhabditis elegans


Alignment Length:191 Identity:48/191 - (25%)
Similarity:75/191 - (39%) Gaps:42/191 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 SPPLVDQMSGHHMNAQMTLPHHMGHP-----QAQLGY--TDVGVPDVTEVHQNHHNMGMYQQQSG 236
            ||..:.....:....|...|.::..|     |.||.:  .|:.|....:.:|........||.|.
 Worm    43 SPGSMSSSPAYPAAYQAPSPCYVADPNQLYYQQQLAHNGNDMLVQAHAQAYQAQCFAWFQQQYSQ 107

  Fly   237 VPPVGAP-PQGMMHQGQGPP------QMHQGHPGQHTPPSQNPNSQSSGMPSPLYPWMRSQFGKC 294
            :.|...| |....|.|..||      ..||.||  ..|..:...:::....|.||. :|::|.:|
 Worm   108 LSPSSFPHPMVAHHAGFIPPPPSFLHHQHQQHP--RAPSEKRRGARTPFSDSQLYA-LRTRFEQC 169

  Fly   295 QERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKE 355
                         .|:::::            |.::...:.|:..||||||||||.|.:||
 Worm   170 -------------DTIKVDE------------RRKLGAVIGLSPEQIKIWFQNRRFKLRKE 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 32/140 (23%)
Homeobox 301..354 CDD:395001 14/52 (27%)
ceh-51NP_507685.1 Homeobox 151..204 CDD:365835 20/78 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.