DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and egl-5

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001021166.1 Gene:egl-5 / 176093 WormBaseID:WBGene00001174 Length:223 Species:Caenorhabditis elegans


Alignment Length:133 Identity:53/133 - (39%)
Similarity:70/133 - (52%) Gaps:16/133 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 QGQGPPQMHQGHPGQHTPPSQNPNSQSSGMPSPLYP---WMRSQFGKC-QERKRGRQTYTRYQTL 310
            |..|.|| :..:.||...|:..|     |.|. .||   |  ..:|:. ...|:|||||.||||.
 Worm    70 QSYGWPQ-NYNYFGQPLGPATFP-----GWPQ-CYPNTAW--PNYGELFASSKKGRQTYQRYQTS 125

  Fly   311 ELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSGGEGDEITPPN 375
            .||.:|..:.|:::::|.|:.....||:|||||||||||||.|||   |.......|...:.|.|
 Worm   126 VLEAKFQQSSYVSKKQREELRLQTQLTDRQIKIWFQNRRMKAKKE---KQRVDDHTEHTPLLPAN 187

  Fly   376 SPQ 378
            .|:
 Worm   188 PPK 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 20/59 (34%)
Homeobox 301..354 CDD:395001 29/52 (56%)
egl-5NP_001021166.1 Homeobox 116..168 CDD:278475 29/51 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.