DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and mab-5

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_498695.1 Gene:mab-5 / 176091 WormBaseID:WBGene00003102 Length:200 Species:Caenorhabditis elegans


Alignment Length:119 Identity:64/119 - (53%)
Similarity:79/119 - (66%) Gaps:9/119 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 HQGHPGQHTP---PSQNPNSQSSGMPS---PLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEF 316
            :..:|..:.|   .|.|.....:.||:   |::|||:....|..|.||.||||:|.|||||||||
 Worm    72 NSSNPFAYNPLQATSANFGETRTSMPAISQPVFPWMKMGGAKGGESKRTRQTYSRSQTLELEKEF 136

  Fly   317 HFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSGGEGDE 370
            |:::||||:||.||:..|.|||||:||||||||||.|||  .|||.|| .|.||
 Worm   137 HYHKYLTRKRRQEISETLHLTERQVKIWFQNRRMKHKKE--AKGEGGS-NESDE 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 18/53 (34%)
Homeobox 301..354 CDD:395001 39/52 (75%)
mab-5NP_498695.1 Homeobox 120..173 CDD:278475 39/52 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I4800
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - oto17439
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2625
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.