DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and DLX5

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_005212.1 Gene:DLX5 / 1749 HGNCID:2918 Length:289 Species:Homo sapiens


Alignment Length:226 Identity:54/226 - (23%)
Similarity:78/226 - (34%) Gaps:67/226 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 PQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVP-----------PVGAPPQGMMHQGQGP--- 254
            |..:.|  |...|..|....:|.:    |:...:|           |.|..|.|........   
Human    10 PSIRSG--DFQAPFQTSAAMHHPS----QESPTLPESSATDSDYYSPTGGAPHGYCSPTSASYGK 68

  Fly   255 ---PQMHQGHPGQHTPPSQNPNSQSSGMPSPLY-------------------------------- 284
               |..:|.|         ..|..:...|:..|                                
Human    69 ALNPYQYQYH---------GVNGSAGSYPAKAYADYSYASSYHQYGGAYNRVPSATNQPEKEVTE 124

  Fly   285 PWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRR 349
            |.:|...||.::.::.|..|:.:|...|::.|...:||....|.|:|.:|.||:.|:||||||:|
Human   125 PEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKR 189

  Fly   350 MKWKKENKTKGE--PGSGGEGDEITPPNSPQ 378
            .|.||..| .||  |.......:....||||
Human   190 SKIKKIMK-NGEMPPEHSPSSSDPMACNSPQ 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 24/150 (16%)
Homeodomain 298..354 CDD:459649 22/55 (40%)
DLX5NP_005212.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49 8/44 (18%)
DLL_N 32..118 CDD:463567 12/94 (13%)
Homeodomain 138..194 CDD:459649 22/55 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..251 7/22 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 270..289
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.