DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Meox1

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_036012267.1 Gene:Meox1 / 17285 MGIID:103220 Length:271 Species:Mus musculus


Alignment Length:58 Identity:18/58 - (31%)
Similarity:28/58 - (48%) Gaps:5/58 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 SQNQQQQQAQQAPQQLQQQLPQVTQQVTHPQQQQQQPVVYASCKLQAAVGGLGMVPEG 177
            |::|.|::.::.|.|.....|.::...|||    .||.....|::...||.|.. |||
Mouse   198 SKDQNQERLKEPPLQFPPPGPTLSHLWTHP----GQPAHTLRCEVAQYVGALNF-PEG 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 7/17 (41%)
Homeodomain 298..354 CDD:459649
Meox1XP_036012267.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.