DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and ceh-12

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_491693.1 Gene:ceh-12 / 172255 WormBaseID:WBGene00000436 Length:180 Species:Caenorhabditis elegans


Alignment Length:159 Identity:47/159 - (29%)
Similarity:64/159 - (40%) Gaps:64/159 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 QGPPQMHQGHPGQHTPPSQNPNSQSS--------------------------------------- 277
            |...|..:.||   :||||.||..:|                                       
 Worm    17 QNEDQKLESHP---SPPSQIPNYSTSCSEELMKMAAKAAQFAAQASLENSFSSSTSPTSTVTPLS 78

  Fly   278 ---GMPSPLYP--------------WMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRR 325
               .:..|:.|              |  ..:||   .:|.|..::..|.::|||:|..||||:|.
 Worm    79 AYTSLVQPVLPLIYDHLALTYSVNAW--QAWGK---MRRPRTAFSSEQLVQLEKQFSDNRYLSRP 138

  Fly   326 RRIEIAHALCLTERQIKIWFQNRRMKWKK 354
            ||.::|..|.|:|.||||||||||||.|:
 Worm   139 RRYQLAQQLSLSETQIKIWFQNRRMKNKR 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 18/109 (17%)
Homeodomain 298..354 CDD:459649 30/55 (55%)
ceh-12NP_491693.1 Homeodomain 111..167 CDD:459649 30/55 (55%)

Return to query results.
Submit another query.