DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and GSX2

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_573574.2 Gene:GSX2 / 170825 HGNCID:24959 Length:304 Species:Homo sapiens


Alignment Length:325 Identity:83/325 - (25%)
Similarity:103/325 - (31%) Gaps:151/325 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 PQVTQQVTHPQQQQQQPVVYASCKL---------QAAVG------GLGMVPEGGS---------P 180
            |.:...|:.|....::...:..|.|         :.:||      |.|:...|||         |
Human    39 PPLVMSVSGPGCPSRKSGAFCVCPLCVTSHLHSSRGSVGAGSGGAGAGVTGAGGSGVAGAAGALP 103

  Fly   181 PLVDQMSGHHMNAQMTLPHHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQ 245
            .|..|.|....:||.                   .|.|...|.:||                |||
Human   104 LLKGQFSSAPGDAQF-------------------CPRVNHAHHHHH----------------PPQ 133

  Fly   246 GMMHQGQGPPQM------------------HQGHPGQHTP------------------------P 268
            ...|..|  ||.                  ..|||..|.|                        .
Human   134 HHHHHHQ--PQQPGSAAAAAAAAAAAAAAAALGHPQHHAPVCTATTYNVADPRRFHCLTMGGSDA 196

  Fly   269 SQNPNSQSSGMPSPLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHA 333
            ||.||.                       ||.|..:|..|.||||:||..|.||:|.||||||..
Human   197 SQVPNG-----------------------KRMRTAFTSTQLLELEREFSSNMYLSRLRRIEIATY 238

  Fly   334 LCLTERQIKIWFQNRRMKWKKENK-------------------TKGE------PGSGGEGDEITP 373
            |.|:|:|:||||||||:|.|||.|                   .:.|      |.|..:..||:|
Human   239 LNLSEKQVKIWFQNRRVKHKKEGKGTQRNSHAGCKCVGSQVHYARSEDEDSLSPASANDDKEISP 303

  Fly   374  373
            Human   304  303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 39/210 (19%)
Homeobox 301..354 CDD:395001 32/52 (62%)
GSX2NP_573574.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..151 14/71 (20%)
Homeobox 206..258 CDD:306543 32/51 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 283..304 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.