DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Lbx2

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_034822.1 Gene:Lbx2 / 16815 MGIID:1342288 Length:195 Species:Mus musculus


Alignment Length:178 Identity:41/178 - (23%)
Similarity:60/178 - (33%) Gaps:62/178 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 VPPVGAPPQGMM-------------HQGQGPPQMHQGHPGQHTPPSQNPNSQSSGMPSPLYPWMR 288
            :|..|..|...:             |..:..||..:|......||     ...:|:         
Mouse    31 LPEAGPDPASPLCALEELASKTFLGHSPRATPQPSEGRAAPEAPP-----GPGAGV--------- 81

  Fly   289 SQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWK 353
                  :.|::.|..:|..|.||||:.|.|.:||....|..:|..|.|...|:..||||||.|.|
Mouse    82 ------RRRRKSRTAFTAQQVLELERRFVFQKYLAPSERDGLAARLGLANAQVVTWFQNRRAKLK 140

  Fly   354 K--------------------------ENKTKGEPGSGGEGDEITPPN 375
            :                          ::.:..:||..|...|   ||
Mouse   141 RDVEEMRADVASLCGLSPGVLCYPALPDSTSSPDPGPSGPDSE---PN 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 12/81 (15%)
Homeodomain 298..354 CDD:459649 23/55 (42%)
Lbx2NP_034822.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..89 11/77 (14%)
Homeodomain 85..141 CDD:459649 23/55 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 164..195 6/25 (24%)

Return to query results.
Submit another query.