Sequence 1: | NP_996167.1 | Gene: | Antp / 40835 | FlyBaseID: | FBgn0260642 | Length: | 378 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_034599.2 | Gene: | Hoxd4 / 15436 | MGIID: | 96208 | Length: | 250 | Species: | Mus musculus |
Alignment Length: | 256 | Identity: | 90/256 - (35%) |
---|---|---|---|
Similarity: | 105/256 - (41%) | Gaps: | 88/256 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 186 MSGHHMNAQMTLPHHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQ 250
Fly 251 ------------------GQGP---------------PQMHQGHPGQHTP--------------- 267
Fly 268 ---PSQNPNSQSSGMPSPLYPWMRSQFGKC-------QERKRGRQTYTRYQTLELEKEFHFNRYL 322
Fly 323 TRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENK---TKGEPGSGGE-------GDEITP 373 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Antp | NP_996167.1 | KLF1_2_4_N | <161..306 | CDD:425360 | 37/177 (21%) |
Homeobox | 301..354 | CDD:395001 | 46/52 (88%) | ||
Hoxd4 | NP_034599.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 31..126 | 17/94 (18%) | |
Antp-type hexapeptide | 131..136 | 3/4 (75%) | |||
Homeobox | 155..208 | CDD:278475 | 45/52 (87%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 210..250 | 7/29 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X14 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.810 |