DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Hoxd4

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_034599.2 Gene:Hoxd4 / 15436 MGIID:96208 Length:250 Species:Mus musculus


Alignment Length:256 Identity:90/256 - (35%)
Similarity:105/256 - (41%) Gaps:88/256 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 MSGHHMNAQMTLPHHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQ 250
            ||.:.:|::               |.|...|...|..|     |.|..:.|....|:..||...|
Mouse     3 MSSYMVNSK---------------YVDPKFPPCEEYLQ-----GGYLGEQGADYYGSGAQGADFQ 47

  Fly   251 ------------------GQGP---------------PQMHQGHPGQHTP--------------- 267
                              |.||               |..|.|.||:..|               
Mouse    48 PSGLYPRPDFGEQPFGGGGPGPGSALPARGHGQEPSGPGSHYGAPGERCPAPPPAPLPGARACSQ 112

  Fly   268 ---PSQNPNSQSSGMPSPLYPWMRSQFGKC-------QERKRGRQTYTRYQTLELEKEFHFNRYL 322
               |.|.|...:...|:.:||||:......       .|.||.|..|||.|.|||||||||||||
Mouse   113 PTGPKQPPPGTALKQPAVVYPWMKKVHVNSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYL 177

  Fly   323 TRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENK---TKGEPGSGGE-------GDEITP 373
            ||||||||||.|||:|||||||||||||||||::|   |||...|...       |..:.|
Mouse   178 TRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKGRSSSSSSCSSSAAPGQHLQP 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 37/177 (21%)
Homeobox 301..354 CDD:395001 46/52 (88%)
Hoxd4NP_034599.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..126 17/94 (18%)
Antp-type hexapeptide 131..136 3/4 (75%)
Homeobox 155..208 CDD:278475 45/52 (87%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..250 7/29 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.