DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Hoxd1

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_034597.2 Gene:Hoxd1 / 15429 MGIID:96201 Length:328 Species:Mus musculus


Alignment Length:266 Identity:78/266 - (29%)
Similarity:102/266 - (38%) Gaps:80/266 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 LPQVTQQVT--HPQQQQQQPVV------YASCKLQAAVGGLGMVPEG-------GSPPLVDQMSG 188
            ||..|.:.|  .|....|.||.      ||.|.|:.|. ..|..|..       ||.|..|    
Mouse    57 LPLATARPTPSPPAGPAQSPVPQPAAPRYAPCTLEGAY-ERGAAPASAAEYGFLGSGPAFD---- 116

  Fly   189 HHMNAQMTLPHHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMY--------QQQSGVPPVGAPPQ 245
                    .|..:|....:.|           .|.::....::        ..|......|.|  
Mouse   117 --------FPGALGRAADEGG-----------AHVHYATSAVFSGGGSFLLSGQVDFAAFGEP-- 160

  Fly   246 GMMHQGQGP-----PQMHQGHPG--QHTPPS----QNPNSQSSGMPS--PLYPWMR--------- 288
                   ||     .:...||||  |...|:    ..|.|.:|.:|:  ..:.||:         
Mouse   161 -------GPFPACLKEPADGHPGPFQTVSPAPGACPKPASPTSSLPAAHSTFEWMKVKRNAPKKS 218

  Fly   289 --SQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMK 351
              |::|........|..::..|..|||||||||:||||.||||||:.|.|.:.|:||||||||||
Mouse   219 KLSEYGATSPPSAIRTNFSTKQLTELEKEFHFNKYLTRARRIEIANCLQLNDTQVKIWFQNRRMK 283

  Fly   352 WKKENK 357
            .||..:
Mouse   284 QKKRER 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 33/183 (18%)
Homeobox 301..354 CDD:395001 34/52 (65%)
Hoxd1NP_034597.2 PRK04233 59..>105 CDD:305134 13/46 (28%)
Antp-type hexapeptide 204..209 1/4 (25%)
Homeobox 233..285 CDD:278475 34/51 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 304..328
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.