DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Hoxc8

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_034596.1 Gene:Hoxc8 / 15426 MGIID:96198 Length:242 Species:Mus musculus


Alignment Length:219 Identity:86/219 - (39%)
Similarity:110/219 - (50%) Gaps:32/219 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 YASCKLQAAVG---GLGMVPEGGSPPLVDQMSGHHMNAQMTLPHHMGHPQAQLGYTDVGVPDVTE 220
            |..|:...:||   .|...|.|.:|..  |.:.||:   ....||.....:..||          
Mouse    23 YYDCRFPQSVGRSHALVYGPGGSAPGF--QHASHHV---QDFFHHGTSGISNSGY---------- 72

  Fly   221 VHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTPPSQNPNS-------QSSG 278
             .||..::..:...|......|.|:..::..|....:.| :|  ....|.|.||       ..:.
Mouse    73 -QQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQ-YP--DCKSSANTNSSEGQGHLNQNS 133

  Fly   279 MPSPLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKI 343
            .||.::||||..   ...|:.|||||:|||||||||||.||.||||:||||::|||.|||||:||
Mouse   134 SPSLMFPWMRPH---APGRRSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKI 195

  Fly   344 WFQNRRMKWKKENKTKGEPGSGGE 367
            |||||||||||||.....||:..|
Mouse   196 WFQNRRMKWKKENNKDKLPGARDE 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 38/154 (25%)
Homeobox 301..354 CDD:395001 44/52 (85%)
Hoxc8NP_034596.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..154 12/42 (29%)
Antp-type hexapeptide 138..143 2/4 (50%)
Homeobox 153..206 CDD:395001 44/52 (85%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..242 6/14 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4709
Isobase 1 0.950 - 0 Normalized mean entropy S2996
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.