DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Hoxc6

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_006520531.1 Gene:Hoxc6 / 15425 MGIID:96197 Length:243 Species:Mus musculus


Alignment Length:118 Identity:69/118 - (58%)
Similarity:77/118 - (65%) Gaps:21/118 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 GQHTPPSQNPNSQSSGMPSPLYPWMRSQ-------------FGKCQERKRGRQTYTRYQTLELEK 314
            |:..|..|..:.|       :||||:..             .|...:|:||||.|:|||||||||
Mouse   109 GRTAPQDQKASIQ-------IYPWMQRMNSHSVCFVPGSLGVGYGADRRRGRQIYSRYQTLELEK 166

  Fly   315 EFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKE-NKTKGEPGSGG 366
            |||||||||||||||||:||||||||||||||||||||||| |.|....|.||
Mouse   167 EFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKESNLTSTLSGGGG 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 15/55 (27%)
Homeobox 301..354 CDD:395001 49/52 (94%)
Hoxc6XP_006520531.1 Homeobox 153..206 CDD:395001 49/52 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2625
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.