DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Hoxc5

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_783857.1 Gene:Hoxc5 / 15424 MGIID:96196 Length:222 Species:Mus musculus


Alignment Length:361 Identity:100/361 - (27%)
Similarity:127/361 - (35%) Gaps:152/361 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 MTSYFTNSYMGADMHHGHYPGNGVTDLDAQQMHHYSQNANHQGNMPYPRFPPYDRMPYYN-GQGM 74
            |:||..||:                         |.|:         |..|.|:.....| |...
Mouse     1 MSSYVANSF-------------------------YKQS---------PNIPAYNMQTCGNYGSAS 31

  Fly    75 DQQQQHQVYS--------RPDSPSSQVGGVMPQAQTNGQLGVPQQQQQQQQQPSQNQQQQQAQQA 131
            :.|.....|.        .|.:||:.:.||                                   
Mouse    32 EVQASRYCYGGLDLSITFPPPAPSNSLHGV----------------------------------- 61

  Fly   132 PQQLQQQLPQVTQQVTHPQQQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMT 196
                        ....:|:....:|    :|...||.|                           
Mouse    62 ------------DMAANPRAHPDRP----ACSAAAAPG--------------------------- 83

  Fly   197 LPHHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGH 261
              |.:|..:|        .|         .|.|||.|::..|.:..     ..:..|..:..|..
Mouse    84 --HALGRDEA--------AP---------LNPGMYSQKAARPALEE-----RAKSSGEIKEEQAQ 124

  Fly   262 PGQHTPPSQNPNSQSSGMPSPLYPWM-RSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRR 325
            .||....||.|      .|..:|||| :.......:.||.|.:||||||||||||||||||||||
Mouse   125 TGQPAGLSQPP------APPQIYPWMTKLHMSHETDGKRSRTSYTRYQTLELEKEFHFNRYLTRR 183

  Fly   326 RRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGE 361
            ||||||:.|||.|||||||||||||||||::|.|.:
Mouse   184 RRIEIANNLCLNERQIKIWFQNRRMKWKKDSKMKSK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 30/145 (21%)
Homeobox 301..354 CDD:395001 47/52 (90%)
Hoxc5NP_783857.1 COG5373 65..>142 CDD:227665 24/137 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..141 23/133 (17%)
Antp-type hexapeptide 140..145 3/4 (75%)
Homeobox 158..212 CDD:395001 47/53 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.