DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Hoxc12

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_034593.1 Gene:Hoxc12 / 15421 MGIID:96194 Length:280 Species:Mus musculus


Alignment Length:168 Identity:52/168 - (30%)
Similarity:77/168 - (45%) Gaps:46/168 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 GMYQQQSGVPPVGAPPQGMMH-QGQGPPQM------------HQGHPG-QHTPPS---------- 269
            |:.:::.|..|...|...::. :..|||.:            ..|..| .|.|||          
Mouse   106 GLKREERGREPGAGPGAALLQLEPSGPPALGFKYDYTASGGGGDGSTGPPHDPPSCQSLESDSSS 170

  Fly   270 ----QNPNSQSSGMP----SPL----------YPWMRSQFGKCQERKRGRQTYTRYQTLELEKEF 316
                :...|.|:|.|    |||          .||....   .:.||: |:.|::.|..|||.||
Mouse   171 SLLNEGNKSASAGDPGSLVSPLNPGGGLSASGAPWYPIH---SRSRKK-RKPYSKLQLAELEGEF 231

  Fly   317 HFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKK 354
            ..|.::||:||.|::..|.|:::|:||||||||||.|:
Mouse   232 LVNEFITRQRRRELSDRLNLSDQQVKIWFQNRRMKKKR 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 26/118 (22%)
Homeodomain 298..354 CDD:459649 28/55 (51%)
Hoxc12NP_034593.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..212 22/108 (20%)
Homeodomain 213..269 CDD:459649 29/56 (52%)

Return to query results.
Submit another query.