DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Hoxb8

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_034591.1 Gene:Hoxb8 / 15416 MGIID:96189 Length:243 Species:Mus musculus


Alignment Length:201 Identity:81/201 - (40%)
Similarity:99/201 - (49%) Gaps:55/201 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 NHHNMGMYQQQSGVPPVGAPPQ---GMMHQGQ------GPPQMH-------------QGHPG--- 263
            |:::.|..|...|.|.|...|.   ...|..|      ||..:.             .|.||   
Mouse    22 NYYDCGFAQDLGGRPTVVYGPSSGGSFQHPSQIQEFYHGPSSLSTAPYQQNPCAVACHGDPGNFY 86

  Fly   264 -------QHTPPSQNPN---------------------SQSSGMPSPLYPWMRSQFGKCQERKRG 300
                   |....:|:|:                     |:.|..|:.|:||||.|  ....|:||
Mouse    87 GYDPLQRQSLFGAQDPDLVQYADCKLAAASGLGEEAEGSEQSPSPTQLFPWMRPQ--AAAGRRRG 149

  Fly   301 RQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSG 365
            ||||:|||||||||||.||.||||:||||::|||.|||||:|||||||||||||||.....|.|.
Mouse   150 RQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFPSSK 214

  Fly   366 GEGDEI 371
            .|.:|:
Mouse   215 CEQEEL 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 33/134 (25%)
Homeobox 301..354 CDD:395001 44/52 (85%)
Hoxb8NP_034591.1 Antp-type hexapeptide 134..139 3/4 (75%)
Homeobox 150..203 CDD:395001 44/52 (85%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..243 7/18 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4709
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.