DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Hoxb7

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_034590.2 Gene:Hoxb7 / 15415 MGIID:96188 Length:217 Species:Mus musculus


Alignment Length:186 Identity:91/186 - (48%)
Similarity:102/186 - (54%) Gaps:37/186 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 HPQAQLGY-TDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQG-PPQMHQGHPGQH 265
            :|| :.|| ...|.|....|      .|:|  ..|....|....|:...|.| .|.....|   .
Mouse    37 NPQ-RPGYGAGPGAPFSASV------QGLY--SGGGAMAGQSAAGVYAAGYGLEPSSFNMH---C 89

  Fly   266 TPPSQNPNSQSSGMPSP-------------------LYPWMRSQFGKCQERKRGRQTYTRYQTLE 311
            .|..||.:....|.|:.                   :||||||   ...:|||||||||||||||
Mouse    90 APFEQNLSGVCPGDPAKAAGAKEQRDSDLAAESNFRIYPWMRS---SGPDRKRGRQTYTRYQTLE 151

  Fly   312 LEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSGGE 367
            ||||||:||||||||||||||.|||||||||||||||||||||||||.| ||:.|:
Mouse   152 LEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKENKTSG-PGTTGQ 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 35/123 (28%)
Homeobox 301..354 CDD:395001 50/52 (96%)
Hoxb7NP_034590.2 Antp-type hexapeptide 126..131 3/4 (75%)
Homeobox 141..194 CDD:365835 50/52 (96%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 192..217 11/16 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4709
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - otm43293
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3844
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.950

Return to query results.
Submit another query.