DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Hoxb4

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_034589.3 Gene:Hoxb4 / 15412 MGIID:96185 Length:250 Species:Mus musculus


Alignment Length:239 Identity:91/239 - (38%)
Similarity:108/239 - (45%) Gaps:78/239 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 YTDVGVPDVTEVHQ-----NHHNMGMY----QQQSGV---------------------------- 237
            |.|...|...|..|     :.|:.|.|    :::||.                            
Mouse    12 YVDPKFPPCEEYSQSDYLPSDHSPGYYAGGQRRESGFQPEAAFGRRAPCTVQRYAACRDPGPPPP 76

  Fly   238 --PPVGAPPQGMMHQGQGPPQMHQG----HPGQH-----TPPSQNPNSQSSGMPSP--------- 282
              ||...||.|:  ..:.|.|...|    .|||.     :.|...|.:|:...|||         
Mouse    77 PPPPPPPPPPGL--SPRAPVQPTAGALLPEPGQRSEAVSSSPPPPPCAQNPLHPSPSHSACKEPV 139

  Fly   283 LYPWMRSQFGKC-------QERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQ 340
            :|||||......       .|.||.|..|||.|.||||||||:|||||||||:||||||||:|||
Mouse   140 VYPWMRKVHVSTVNPNYAGGEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRVEIAHALCLSERQ 204

  Fly   341 IKIWFQNRRMKWKKENK---TK----GEPGSGGEGDEITPPNSP 377
            ||||||||||||||::|   ||    |..|:.|     .||..|
Mouse   205 IKIWFQNRRMKWKKDHKLPNTKIRSGGTAGAAG-----GPPGRP 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 37/159 (23%)
Homeobox 301..354 CDD:395001 45/52 (87%)
Hoxb4NP_034589.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..133 27/122 (22%)
Antp-type hexapeptide 140..145 3/4 (75%)
Homeobox 164..218 CDD:395001 45/53 (85%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..250 9/30 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.