DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Hoxb3

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001073338.1 Gene:Hoxb3 / 15410 MGIID:96184 Length:433 Species:Mus musculus


Alignment Length:288 Identity:84/288 - (29%)
Similarity:108/288 - (37%) Gaps:105/288 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 QQVTHPQQQQQQPVVYASCKLQAAVGGLG-MVPEGGSPPLVDQMSGHHMN---AQMTLPHHMGHP 204
            |..||.:...|:    ::|.||:    || ..|...|    .:::|..|.   |...||...|.|
Mouse    38 QAATHLEGDYQR----SACSLQS----LGNAAPHAKS----KELNGSCMRPGLAPEPLPAPPGSP 90

  Fly   205 QAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTPPS 269
                                             ||..||.....:...|      |.|.:..||.
Mouse    91 ---------------------------------PPSAAPTSTTSNSNNG------GGPSKSGPPK 116

  Fly   270 QNPNSQSSGMPSPLYPWMRS--QFGKCQE------------------------------------ 296
            ....|.|: :...::|||:.  |..|.:.                                    
Mouse   117 CGAGSNST-LTKQIFPWMKESRQTSKLKNSSPGTAEGCGGGGGGGGGGGGGGGGSSGGGGGGGGG 180

  Fly   297 ----------RKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMK 351
                      .||.|..||..|.:||||||||||||.|.||:|:|:.|.|:||||||||||||||
Mouse   181 GDKSPPGSAASKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRRMK 245

  Fly   352 WKKENKTKG-EPGSGGEGDEITPPNSPQ 378
            :||:.|.|| ...|||.....:||...|
Mouse   246 YKKDQKAKGLASSSGGPSPAGSPPQPMQ 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 34/196 (17%)
Homeobox 301..354 CDD:395001 37/52 (71%)
Hoxb3NP_001073338.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..124 18/103 (17%)
Antp-type hexapeptide 129..134 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..195 4/58 (7%)
Homeobox 195..248 CDD:365835 37/52 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..276 9/25 (36%)
DUF4074 369..431 CDD:372548
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 389..433
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.