DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Hoxa7

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001406200.1 Gene:Hoxa7 / 15404 MGIID:96179 Length:270 Species:Mus musculus


Alignment Length:134 Identity:73/134 - (54%)
Similarity:85/134 - (63%) Gaps:29/134 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 GMMHQGQG---PP-----QMHQGHPGQHTPPSQNPNSQSSGMPSPLYPWMRSQFGKCQERKRGRQ 302
            |.:.|.||   ||     ...:||       .|| .::::|...|             :||||||
Mouse   132 GFLSQRQGELRPPGSLTHHCTRGH-------FQN-GAEANGTEGP-------------DRKRGRQ 175

  Fly   303 TYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSGGE 367
            |||||||||||||||||||||||||||||||||||||||||||||||||||||:|.:.:..:...
Mouse   176 TYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKDESQAPTAAP 240

  Fly   368 GDEI 371
            .|.:
Mouse   241 EDAV 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 20/67 (30%)
Homeodomain 298..354 CDD:459649 55/55 (100%)
Hoxa7NP_001406200.1 Homeodomain 171..227 CDD:459649 55/55 (100%)

Return to query results.
Submit another query.