DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Hoxa7

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_034585.1 Gene:Hoxa7 / 15404 MGIID:96179 Length:229 Species:Mus musculus


Alignment Length:89 Identity:67/89 - (75%)
Similarity:74/89 - (83%) Gaps:3/89 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 LYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQN 347
            :||||||   ...:|||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse   118 IYPWMRS---SGPDRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQN 179

  Fly   348 RRMKWKKENKTKGEPGSGGEGDEI 371
            ||||||||:|.:.:..:....|.:
Mouse   180 RRMKWKKEHKDESQAPTAAPEDAV 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 14/22 (64%)
Homeobox 301..354 CDD:395001 52/52 (100%)
Hoxa7NP_034585.1 Antp-type hexapeptide 118..123 3/4 (75%)
Homeobox 133..185 CDD:278475 51/51 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..229 4/18 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 123 1.000 Domainoid score I5581
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4709
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - otm43293
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3844
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.990

Return to query results.
Submit another query.