DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Hoxa6

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_034584.1 Gene:Hoxa6 / 15403 MGIID:96178 Length:232 Species:Mus musculus


Alignment Length:143 Identity:80/143 - (55%)
Similarity:87/143 - (60%) Gaps:15/143 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 GAPPQGMMHQGQGPPQMHQGHPGQHTPPS---QNPNSQSSG----MPSPLYPWMRSQFGKC---- 294
            ||.|.|...| :||.......|.|...|.   |.......|    ..||:||||: :...|    
Mouse    87 GASPSGNNKQ-RGPGDYLHFSPEQQYKPDGSVQGKALHEEGTDRKYTSPVYPWMQ-RMNSCAGAV 149

  Fly   295 --QERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENK 357
              ...:|||||||||||||||||||||||||||||||||:|||||||||||||||||||||||||
Mouse   150 YGSHGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKENK 214

  Fly   358 TKGEPGSGGEGDE 370
            ......:.||..|
Mouse   215 LINSTQASGEDSE 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 25/77 (32%)
Homeobox 301..354 CDD:395001 51/52 (98%)
Hoxa6NP_034584.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..126 10/38 (26%)
Antp-type hexapeptide 135..140 3/4 (75%)
Homeobox 158..210 CDD:278475 50/51 (98%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2625
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.