DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Hoxa3

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_034582.1 Gene:Hoxa3 / 15400 MGIID:96175 Length:443 Species:Mus musculus


Alignment Length:270 Identity:91/270 - (33%)
Similarity:113/270 - (41%) Gaps:83/270 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 GGSPPLVDQMSGHHMNAQMTLPHHMGHPQAQLGYTDVGV-----------PDVTEVHQNHHNM-- 228
            ||.|  ....:|...||... |:   .|.|.|| || ||           |.....|...|.:  
Mouse    14 GGYP--YQAANGFAYNASQQ-PY---APSAALG-TD-GVEYHRPACSLQSPASAGGHPKTHELSE 70

  Fly   229 -------GMYQQQSGV--------PPVGAPPQGMMHQGQGPPQMHQGHPGQHTPPSQ-NPNSQSS 277
                   |...|..|:        ||..|||  .....|.|||.....|....|||. :|...::
Mouse    71 ACLRTLSGPPSQPPGLGEPPLPPPPPQAAPP--APQPPQPPPQPPAPTPAAPPPPSSVSPPQSAN 133

  Fly   278 GMPSP-----------------LYPWMRSQFGKCQER----------------------KRGRQT 303
            ..|:|                 ::|||:......:::                      ||.|..
Mouse   134 SNPTPASTAKSPLLNSPTVGKQIFPWMKESRQNTKQKTSGSSSGESCAGDKSPPGQASSKRARTA 198

  Fly   304 YTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGE-PGSGGE 367
            ||..|.:||||||||||||.|.||:|:|:.|.||||||||||||||||:||:.|.||. ..|||:
Mouse   199 YTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKGKGMLTSSGGQ 263

  Fly   368 GDEITPPNSP 377
                :|..||
Mouse   264 ----SPSRSP 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 44/196 (22%)
Homeobox 301..354 CDD:395001 38/52 (73%)
Hoxa3NP_034582.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 74..151 19/78 (24%)
Antp-type hexapeptide 156..161 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..197 2/33 (6%)
COG5576 <182..309 CDD:227863 51/92 (55%)
Homeobox 196..249 CDD:365835 38/52 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 248..354 11/26 (42%)
DUF4074 378..441 CDD:372548
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 401..443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.