Sequence 1: | NP_996167.1 | Gene: | Antp / 40835 | FlyBaseID: | FBgn0260642 | Length: | 378 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_034582.1 | Gene: | Hoxa3 / 15400 | MGIID: | 96175 | Length: | 443 | Species: | Mus musculus |
Alignment Length: | 270 | Identity: | 91/270 - (33%) |
---|---|---|---|
Similarity: | 113/270 - (41%) | Gaps: | 83/270 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 177 GGSPPLVDQMSGHHMNAQMTLPHHMGHPQAQLGYTDVGV-----------PDVTEVHQNHHNM-- 228
Fly 229 -------GMYQQQSGV--------PPVGAPPQGMMHQGQGPPQMHQGHPGQHTPPSQ-NPNSQSS 277
Fly 278 GMPSP-----------------LYPWMRSQFGKCQER----------------------KRGRQT 303
Fly 304 YTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGE-PGSGGE 367
Fly 368 GDEITPPNSP 377 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Antp | NP_996167.1 | KLF1_2_4_N | <161..306 | CDD:425360 | 44/196 (22%) |
Homeobox | 301..354 | CDD:395001 | 38/52 (73%) | ||
Hoxa3 | NP_034582.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 74..151 | 19/78 (24%) | |
Antp-type hexapeptide | 156..161 | 2/4 (50%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 163..197 | 2/33 (6%) | |||
COG5576 | <182..309 | CDD:227863 | 51/92 (55%) | ||
Homeobox | 196..249 | CDD:365835 | 38/52 (73%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 248..354 | 11/26 (42%) | |||
DUF4074 | 378..441 | CDD:372548 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 401..443 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |