DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Hoxa2

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_034581.1 Gene:Hoxa2 / 15399 MGIID:96174 Length:372 Species:Mus musculus


Alignment Length:186 Identity:64/186 - (34%)
Similarity:82/186 - (44%) Gaps:58/186 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 PPVGAPPQG-------MMHQGQGPPQMHQG----HPGQH---------TPPSQNPNSQSSGMPS- 281
            |||....|.       :.|....||...|.    :||.|         .|.|....|:.|.:|: 
Mouse    26 PPVADTFQSSSIKTSTLSHSTLIPPPFEQTIPSLNPGSHPRHGAGVGGRPKSSPAGSRGSPVPAG 90

  Fly   282 ----PLYPWMRSQFGKCQER-------------------------------KRGRQTYTRYQTLE 311
                |.||||:.:  |..::                               :|.|..||..|.||
Mouse    91 ALQPPEYPWMKEK--KAAKKTALPPAAASTGPACLGHKESLEIADGSGGGSRRLRTAYTNTQLLE 153

  Fly   312 LEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSGGE 367
            ||||||||:||.|.||:|||..|.|||||:|:||||||||.|::.:.|....|.|:
Mouse   154 LEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQCKENQNSEGK 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 25/123 (20%)
Homeobox 301..354 CDD:395001 37/52 (71%)
Hoxa2NP_034581.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..95 11/46 (24%)
Antp-type hexapeptide 96..101 3/4 (75%)
Homeobox 143..195 CDD:278475 37/51 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..225 4/16 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.