DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Hoxa13

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_032290.1 Gene:Hoxa13 / 15398 MGIID:96173 Length:386 Species:Mus musculus


Alignment Length:176 Identity:56/176 - (31%)
Similarity:82/176 - (46%) Gaps:43/176 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 PHHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAP------PQGMMHQGQGPPQ 256
            |:|  |.|...||.|:.|                     ||.:|.|      |.|:..:...|..
Mouse   237 PYH--HHQPVPGYLDMPV---------------------VPGLGGPGESRHEPLGLPMESYQPWA 278

  Fly   257 MHQGHPGQHTPP---SQNPNSQSSGMPSPL-YPWMRSQFGKCQERKRGRQ---TYTRYQTLELEK 314
            :..|..||...|   :|.|:...|.:|..: :|...|.:      :|||:   .||:.|..|||:
Mouse   279 LPNGWNGQMYCPKEQTQPPHLWKSTLPDVVSHPSDASSY------RRGRKKRVPYTKVQLKELER 337

  Fly   315 EFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKE-NKTK 359
            |:..|:::|:.:|..|:....|:|||:.|||||||:|.||. ||.|
Mouse   338 EYATNKFITKDKRRRISATTNLSERQVTIWFQNRRVKEKKVINKLK 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 29/120 (24%)
Homeodomain 298..354 CDD:459649 26/58 (45%)
Hoxa13NP_032290.1 HoxA13_N <151..222 CDD:463521
Homeodomain 321..377 CDD:459649 24/55 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.