DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Hhex

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_032271.1 Gene:Hhex / 15242 MGIID:96086 Length:271 Species:Mus musculus


Alignment Length:132 Identity:45/132 - (34%)
Similarity:61/132 - (46%) Gaps:33/132 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 PPQMHQG---HPGQHTPPSQNPNSQSSGMPSPLYPWMRS------------QFGK---------- 293
            |..:|..   ||......:..|    ||...||||:.|:            ..||          
Mouse    73 PTPVHPAFSHHPAAALAAAYGP----SGFGGPLYPFPRTVNDYTHALLRHDPLGKPLLWSPFLQR 133

  Fly   294 -CQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKW---KK 354
             ..:||.|:..::..||:||||:|...:||:...|..:|..|.|:|||:|.||||||.||   |:
Mouse   134 PLHKRKGGQVRFSNDQTVELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRLKQ 198

  Fly   355 EN 356
            ||
Mouse   199 EN 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 17/77 (22%)
Homeodomain 298..354 CDD:459649 27/58 (47%)
HhexNP_032271.1 Interaction with SOX13. /evidence=ECO:0000250|UniProtKB:Q03014 1..138 14/68 (21%)
Required for WNT signaling induction. /evidence=ECO:0000250|UniProtKB:Q03014 138..271 31/63 (49%)
Homeodomain 143..195 CDD:459649 25/51 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 195..271 3/6 (50%)

Return to query results.
Submit another query.