DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Gsx2

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_573555.1 Gene:Gsx2 / 14843 MGIID:95843 Length:305 Species:Mus musculus


Alignment Length:262 Identity:77/262 - (29%)
Similarity:94/262 - (35%) Gaps:99/262 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 AAVGGLGMVPEGGSPPLV-DQMSGHHMNAQ----MTLPHHMGHPQAQLGYTDVGVPDVTEVHQNH 225
            |||.|.|:....|:.||: .|.|....:||    ::..||..||..               |.:|
Mouse    88 AAVAGGGVAGGTGALPLLKSQFSPAPGDAQFCPRVSHAHHHHHPPQ---------------HHHH 137

  Fly   226 HNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTP----------------------- 267
            |:.   .||.|.....|....    .........|||..|.|                       
Mouse   138 HHQ---PQQPGSAAAAAAAAA----AAAAAAAALGHPQHHAPVCAATTYNMSDPRRFHCLSMGGS 195

  Fly   268 -PSQNPNSQSSGMPSPLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIA 331
             .||.||.                       ||.|..:|..|.||||:||..|.||:|.||||||
Mouse   196 DTSQVPNG-----------------------KRMRTAFTSTQLLELEREFSSNMYLSRLRRIEIA 237

  Fly   332 HALCLTERQIKIWFQNRRMKWKKENK-------------------TKGE------PGSGGEGDEI 371
            ..|.|:|:|:||||||||:|.|||.|                   .:.|      |.|..|..||
Mouse   238 TYLNLSEKQVKIWFQNRRVKHKKEGKGASRNNHTSCKCVGSQAHYARSEDEDSLSPASANEDKEI 302

  Fly   372 TP 373
            :|
Mouse   303 SP 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 35/168 (21%)
Homeobox 301..354 CDD:395001 32/52 (62%)
Gsx2NP_573555.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..151 12/53 (23%)
Homeobox 207..259 CDD:278475 32/51 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 259..305 11/46 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.