DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Gbx2

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_034392.1 Gene:Gbx2 / 14472 MGIID:95668 Length:348 Species:Mus musculus


Alignment Length:124 Identity:50/124 - (40%)
Similarity:62/124 - (50%) Gaps:25/124 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 PQGMMHQGQGPPQMHQGHPGQHTPPSQNPNSQSSGMPSPLYPWMRSQFGKCQERKRGRQTYTRYQ 308
            |....|:.:.|     ||..:.||       ||.|...     ..:..||   .:|.|..:|..|
Mouse   214 PGQTAHKEEDP-----GHALEETP-------QSGGAAG-----STTSTGK---NRRRRTAFTSEQ 258

  Fly   309 TLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKK-----ENKTKGEP 362
            .||||||||..:||:...|.:|||||.|:|.|:||||||||.|||:     .|...|||
Mouse   259 LLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRVKAGNANSKTGEP 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 14/61 (23%)
Homeodomain 298..354 CDD:459649 33/55 (60%)
Gbx2NP_034392.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..81
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..139
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..251 13/56 (23%)
Homeodomain 248..304 CDD:459649 33/55 (60%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.