DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and NKX2-6

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001129743.2 Gene:NKX2-6 / 137814 HGNCID:32940 Length:301 Species:Homo sapiens


Alignment Length:171 Identity:53/171 - (30%)
Similarity:78/171 - (45%) Gaps:28/171 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 PDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMM-----HQGQGPPQMHQGHP---GQHTPPSQNP 272
            |..:||| |....|..::..|..|.|.|.:.::     ..|:..|.::...|   |...|.....
Human    50 PRGSEVH-NAGGGGGDRKLDGSEPPGGPCEAVLEMDAERMGEPQPGLNAASPLGGGTRVPERGVG 113

  Fly   273 NSQSSGMPSPLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLT 337
            ||..|....      ||:..|.::|::.|..:::.|.|.||:.|...|||:...|..:|.||.||
Human   114 NSGDSVRGG------RSEQPKARQRRKPRVLFSQAQVLALERRFKQQRYLSAPEREHLASALQLT 172

  Fly   338 ERQIKIWFQNRRMKWKKENKTK-----GEPGSGGEGDEITP 373
            ..|:||||||||.|.|::.:.|     |.|        :||
Human   173 STQVKIWFQNRRYKCKRQRQDKSLELAGHP--------LTP 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 23/97 (24%)
Homeodomain 298..354 CDD:459649 25/55 (45%)
NKX2-6NP_001129743.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..135 22/91 (24%)
Homeodomain 133..189 CDD:459649 25/55 (45%)

Return to query results.
Submit another query.