DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Barx1

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_031552.2 Gene:Barx1 / 12022 MGIID:103124 Length:254 Species:Mus musculus


Alignment Length:212 Identity:54/212 - (25%)
Similarity:81/212 - (38%) Gaps:59/212 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 PEGGSPPLVDQMSGHHMNAQMTLPHHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQ-QQSGV- 237
            |:|.:|......:|..:.                    .||..:......|.::.:.: :|:.| 
Mouse    41 PKGAAPAAAAAAAGELLK--------------------FGVQALLAARPFHSHLAVLKAEQAAVF 85

  Fly   238 ----PPVGAPPQGMMHQGQGPPQMHQGHPG----QHTPPSQNPNSQ----SSGMPSPLYPWMRSQ 290
                .|:|....|......||     |.||    .|.|.......:    .||.|.         
Mouse    86 KFPLAPLGCSGLGSALLAAGP-----GMPGPAGASHLPLELQLRGKLEAAGSGEPG--------- 136

  Fly   291 FGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKK- 354
             .|.::.:|.|..:|..|.:.|||.|...:||:...||::|.:|.|::.|:|.|:||||||||| 
Mouse   137 -AKAKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKKI 200

  Fly   355 ---------ENKTKGEP 362
                     ..|.||.|
Mouse   201 VLQGGGLESPTKPKGRP 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 25/144 (17%)
Homeodomain 298..354 CDD:459649 25/55 (45%)
Barx1NP_031552.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Homeodomain 143..199 CDD:459649 25/55 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..254 4/14 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.