DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Prrx2

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001402085.1 Gene:Prrx2 / 113931 RGDID:1311471 Length:248 Species:Rattus norvegicus


Alignment Length:148 Identity:39/148 - (26%)
Similarity:62/148 - (41%) Gaps:36/148 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 GP---PQMHQGHPGQHTPPSQNPNSQSSG---------MPSPLYPWMRSQFGKCQERK----RGR 301
            ||   |:..:|       .::.|:..|||         .|||.:       |...:||    |.|
  Rat    53 GPVPGPEAREG-------AAREPSGGSSGSEAAPQDGDCPSPGH-------GSATKRKKKQRRNR 103

  Fly   302 QTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSG- 365
            .|:...|...||:.|....|.....|.|:|..:.|:|.::::||||||.|:::..:......|. 
  Rat   104 TTFNSSQLQALERVFERTHYPDAFVREELARRVNLSEARVQVWFQNRRAKFRRNERAMLATRSAS 168

  Fly   366 -----GEGDEITPPNSPQ 378
                 |:...|..|.:|:
  Rat   169 LLKSYGQEAAIEQPVAPR 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 17/68 (25%)
Homeodomain 298..354 CDD:459649 21/59 (36%)
Prrx2NP_001402085.1 Homeodomain 104..156 CDD:459649 18/51 (35%)
COG5576 <110..214 CDD:227863 22/77 (29%)
OAR 222..238 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.