DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Hoxb2

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_598793.2 Gene:Hoxb2 / 103889 MGIID:96183 Length:354 Species:Mus musculus


Alignment Length:215 Identity:67/215 - (31%)
Similarity:87/215 - (40%) Gaps:74/215 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 PDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTPPS--QNPNSQSS- 277
            |.|.|..|.    ...::.:.:||              ||.:.|..|......|  |.|.||.. 
Mouse    26 PAVLETFQT----SSIKESTLIPP--------------PPPLEQTFPSLQLGASTLQRPGSQKQA 72

  Fly   278 --------------GMPSPLYPWMR------------------------SQFGKCQE-------- 296
                          ..|:|.:|||:                        |:.|...:        
Mouse    73 GDGPALRSPPPLPVAPPAPEFPWMKEKKSTKKPSQSAASPSPAASSVRASEVGSPSDGPGLPECG 137

  Fly   297 ---RKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENK- 357
               .:|.|..||..|.||||||||||:||.|.||:|||..|.|||||:|:||||||||.|::.: 
Mouse   138 GSGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQH 202

  Fly   358 ---TKGEPGSGGEGDEITPP 374
               .:||||.....|:...|
Mouse   203 REPPEGEPGGPSAQDDAGEP 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 25/141 (18%)
Homeobox 301..354 CDD:395001 37/52 (71%)
Hoxb2NP_598793.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..143 18/117 (15%)
Antp-type hexapeptide 92..97 2/4 (50%)
Homeobox 145..197 CDD:278475 37/51 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..231 10/30 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 246..295
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.