Sequence 1: | NP_996167.1 | Gene: | Antp / 40835 | FlyBaseID: | FBgn0260642 | Length: | 378 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_598793.2 | Gene: | Hoxb2 / 103889 | MGIID: | 96183 | Length: | 354 | Species: | Mus musculus |
Alignment Length: | 215 | Identity: | 67/215 - (31%) |
---|---|---|---|
Similarity: | 87/215 - (40%) | Gaps: | 74/215 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 216 PDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTPPS--QNPNSQSS- 277
Fly 278 --------------GMPSPLYPWMR------------------------SQFGKCQE-------- 296
Fly 297 ---RKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENK- 357
Fly 358 ---TKGEPGSGGEGDEITPP 374 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Antp | NP_996167.1 | KLF1_2_4_N | <161..306 | CDD:425360 | 25/141 (18%) |
Homeobox | 301..354 | CDD:395001 | 37/52 (71%) | ||
Hoxb2 | NP_598793.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 39..143 | 18/117 (15%) | |
Antp-type hexapeptide | 92..97 | 2/4 (50%) | |||
Homeobox | 145..197 | CDD:278475 | 37/51 (73%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 193..231 | 10/30 (33%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 246..295 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.810 |