DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Hoxa1

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_037207.2 Gene:Hoxa1 / 103690132 RGDID:11414885 Length:334 Species:Rattus norvegicus


Alignment Length:334 Identity:92/334 - (27%)
Similarity:126/334 - (37%) Gaps:99/334 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 DRMPYYNGQGMDQQQQHQVYSRPDSPSSQVGGVMPQAQTNGQLGVPQQQQQQQQQPSQNQQQQQA 128
            ||  :..|:|:.....|..:.....|....      .||:|.|||  ........||...|...|
  Rat    51 DR--FLGGRGVQITSPHHHHHHHHHPQPAT------YQTSGNLGV--SYSHSSCGPSYGAQNFSA 105

  Fly   129 QQAPQQLQQQLPQVTQQVTHPQQQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNA 193
            ...|..|.|                           :|.|       .||.||....:...::::
  Rat   106 PYGPYGLNQ---------------------------EADV-------SGGYPPCAPAVYSGNLSS 136

  Fly   194 QMTLPHHMGHPQAQLGYTDVGVPDVTEVH----QNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGP 254
            .|...||  |.|...|.| ||.|..  :|    |.|.::.:....:.:.|:.|            
  Rat   137 PMVQHHH--HHQGYAGGT-VGSPQY--IHHSYGQEHQSLALATYNNSLSPLHA------------ 184

  Fly   255 PQMHQGHPGQHTPPSQNPNSQSSGMPSPLYPWMR-----------SQFGKCQERKRGRQTYTRYQ 308
                     .|....::|.|::|. |:..:.||:           .::|...:....|..:|..|
  Rat   185 ---------SHQEACRSPASETSS-PAQTFDWMKVKRNPPKTGKVGEYGYVGQPNAVRTNFTTKQ 239

  Fly   309 TLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSGGEG----D 369
            ..|||||||||:||||.||:|||.:|.|.|.|:||||||||||.||..|         ||    .
  Rat   240 LTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKREK---------EGLLPIS 295

  Fly   370 EITPPNSPQ 378
            ..|||.|.:
  Rat   296 PATPPGSDE 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 30/159 (19%)
Homeobox 301..354 CDD:395001 35/52 (67%)
Hoxa1NP_037207.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..82 3/26 (12%)
Interaction with OGT. /evidence=ECO:0000250|UniProtKB:P09022 74..202 40/196 (20%)
COG5576 175..>285 CDD:227863 45/131 (34%)
Antp-type hexapeptide 203..208 1/4 (25%)
Homeobox 232..284 CDD:278475 35/51 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..334 12/34 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.