DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and hoxc6

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_004911991.1 Gene:hoxc6 / 101733663 XenbaseID:XB-GENE-478131 Length:242 Species:Xenopus tropicalis


Alignment Length:137 Identity:70/137 - (51%)
Similarity:81/137 - (59%) Gaps:21/137 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 QMHQGHPGQHTPPSQNPNSQSSGMPS------PLYPWMRSQ-------------FGKCQERKRGR 301
            |...||..|.:......:.||.|...      .:||||:..             .|...:|:|||
 Frog    89 QNSMGHNTQSSLAQDFSSEQSRGNGQEQKGSIQIYPWMQRMNSHSVCLVSDSLGVGYGADRRRGR 153

  Fly   302 QTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKG--EPGS 364
            |.|:||||||||||||||||||||||||||:|||||||||||||||||||||||:....  ..|:
 Frog   154 QIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKESNLTSTLSGGT 218

  Fly   365 GGEGDEI 371
            |...|.:
 Frog   219 GAAADSL 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 18/68 (26%)
Homeodomain 298..354 CDD:459649 51/55 (93%)
hoxc6XP_004911991.1 Homeodomain 150..206 CDD:459649 51/55 (93%)

Return to query results.
Submit another query.