DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and mnx1

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_002935225.2 Gene:mnx1 / 100496534 XenbaseID:XB-GENE-919890 Length:338 Species:Xenopus tropicalis


Alignment Length:246 Identity:76/246 - (30%)
Similarity:101/246 - (41%) Gaps:58/246 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 PQQQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHHMGHPQAQLGYTDV 213
            |.:.|..|:...:....:::.      ..||||     |.|..:.:...|    .|....|.  |
 Frog    17 PPKSQTSPLALVTSLSSSSLS------NSGSPP-----SEHTDSLRTDTP----SPPRTCGL--V 64

  Fly   214 GVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGM-------------MHQGQGP------PQMHQ 259
            ..|.....||:..||.....|:.   .|.|||.:             :..||.|      |||..
 Frog    65 PKPGFLSSHQHPINMMALHPQAA---PGIPPQALYGHPMYSYSAAAALAAGQHPALSYPYPQMQG 126

  Fly   260 GHPGQH-TPP----------SQNPNSQSSGMPSPLYPWMRSQ-----FGKCQERKRGRQTYTRYQ 308
            .|...| ..|          .|...:.::||..|......||     .|||   :|.|..:|..|
 Frog   127 AHHAHHPVDPIKISAGTFQLDQWLRASTAGMMLPKMADFNSQAQSNLLGKC---RRPRTAFTSQQ 188

  Fly   309 TLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTK 359
            .||||.:|..|:||:|.:|.|:|.:|.|||.|:||||||||||||:..|.|
 Frog   189 LLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSKKAK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 40/179 (22%)
Homeobox 301..354 CDD:395001 31/52 (60%)
mnx1XP_002935225.2 Homeobox 180..234 CDD:395001 31/53 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.