DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and rax2

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_002941436.1 Gene:rax2 / 100494721 XenbaseID:XB-GENE-494483 Length:227 Species:Xenopus tropicalis


Alignment Length:92 Identity:29/92 - (31%)
Similarity:47/92 - (51%) Gaps:13/92 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 TPPSQNPNSQSSGMPSPLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEI 330
            ||....|..:.:.:|.             ::.:|.|.|:|.||..|||:.|..:.|.....|.|:
 Frog    18 TPTPGTPEGEDNELPK-------------KKHRRNRTTFTTYQLHELERAFERSHYPDVYSREEL 69

  Fly   331 AHALCLTERQIKIWFQNRRMKWKKENK 357
            |..:.|.|.::::||||||.||:::.|
 Frog    70 AMKVSLPEVRVQVWFQNRRAKWRRQEK 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 7/39 (18%)
Homeodomain 298..354 CDD:459649 24/55 (44%)
rax2XP_002941436.1 Homeodomain 37..93 CDD:459649 24/55 (44%)
OAR 200..216 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.