DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and pdx1

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_002934065.1 Gene:pdx1 / 100490648 XenbaseID:XB-GENE-483331 Length:271 Species:Xenopus tropicalis


Alignment Length:277 Identity:85/277 - (30%)
Similarity:114/277 - (41%) Gaps:84/277 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 NQQQQQAQQAPQQLQQQLPQVTQQVTHPQQQQQQP----VVYASCKLQAAVGGLGMVPEGGSPPL 182
            |...|...|||...:   |...|:   .|.|...|    .:|...:.|||.....:..:.||||.
 Frog     2 NTDDQYYPQAPLYKE---PCAFQR---SQAQDYNPSPPACLYMGRQQQAAYSNPLVALDPGSPPD 60

  Fly   183 VDQMSGHHMNAQMTLPHHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGM 247
            :.......::.:..:||                     :|.:||:                    
 Frog    61 ISPYEVPPISEEPIVPH---------------------LHHHHHH-------------------- 84

  Fly   248 MHQGQGPPQMHQGHPGQHTPPSQNP---NSQSSGMPS------PLYPWMR--------------S 289
             |        |..|||...|..|.|   :::|:.:..      | :|||:              |
 Frog    85 -H--------HHHHPGIPHPHQQMPFPDDTESATLEERNRTLLP-FPWMKSTKSHTWKGQWTGGS 139

  Fly   290 QFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKK 354
            ...:.:|.||.|..|||.|.|||||||.||:|::|.||:|:|..|.||||.||||||||||||||
 Frog   140 YIMEQEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKK 204

  Fly   355 ENKTKGEPGSGGEGDEI 371
            |...|...||..|.|.:
 Frog   205 EEDKKRGRGSDPEQDSV 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 31/167 (19%)
Homeobox 301..354 CDD:395001 37/52 (71%)
pdx1XP_002934065.1 Homeobox 150..204 CDD:365835 37/53 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.