DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and hoxc5

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_002936695.2 Gene:hoxc5 / 100487879 XenbaseID:XB-GENE-485672 Length:225 Species:Xenopus tropicalis


Alignment Length:240 Identity:89/240 - (37%)
Similarity:116/240 - (48%) Gaps:38/240 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 VTQQVTHPQQQQQQPVVYASCKLQAAVGGLGMVPE-----------------GGSPPL--VDQMS 187
            ::..|.:...:|.|.|...|.:.....|.:..||.                 |.|..|  :|..|
 Frog     1 MSSYVANSFYKQSQNVPAYSMQSYGNYGSVSEVPSSRYCYSGLDLSITFPSPGSSNSLSALDMPS 65

  Fly   188 GHHMNAQMTLPHHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQ 252
            ..:.|::......||    ..|:|      |....|:..|.|:|.|::....:....:|:     
 Frog    66 NPNANSERPSCTVMG----SSGHT------VGRGEQSALNSGIYNQKAATTSLEERSKGI----- 115

  Fly   253 GPPQMHQGHPGQHTPPSQNPNSQSSGMPSPLYPWM-RSQFGKCQERKRGRQTYTRYQTLELEKEF 316
               :..:..|.|.||....|..|....|..:|||| :.......:.||.|.:|||||||||||||
 Frog   116 ---ESIKTEPAQSTPQGGQPQQQQQQQPPQIYPWMTKLHMSHETDGKRSRTSYTRYQTLELEKEF 177

  Fly   317 HFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGE 361
            |||||||||||||||:.|||.|||||||||||||||||:.|.|.:
 Frog   178 HFNRYLTRRRRIEIANNLCLNERQIKIWFQNRRMKWKKDTKVKSK 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 36/164 (22%)
Homeobox 301..354 CDD:395001 47/52 (90%)
hoxc5XP_002936695.2 Homeobox 161..215 CDD:395001 47/53 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.