DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Hoxb2

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_002727852.1 Gene:Hoxb2 / 100361765 RGDID:2319509 Length:355 Species:Rattus norvegicus


Alignment Length:208 Identity:67/208 - (32%)
Similarity:88/208 - (42%) Gaps:59/208 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 PDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTPPSQNPNSQSSGM- 279
            |.|.|..|.    ...::.:.:||   ||..:   .|..|.:..|......|.||.|......: 
  Rat    26 PAVLETFQT----SSIKESTLIPP---PPPPL---EQTFPSLQLGASTLQRPGSQKPAGDGPALR 80

  Fly   280 ---------PSPLYPWMR------------------------SQFGKCQE-----------RKRG 300
                     |:|.:|||:                        |..|...:           .:|.
  Rat    81 PPPPLPVAPPAPEFPWMKEKKSAKKPSQSAATPSPAASSVRASGVGSPSDGPGLPESGGSGSRRL 145

  Fly   301 RQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTK----GE 361
            |..||..|.||||||||||:||.|.||:|||..|.|||||:|:||||||||.|::.:.:    ||
  Rat   146 RTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQHREPPDGE 210

  Fly   362 PGSGGEGDEITPP 374
            ||.....|:...|
  Rat   211 PGGLSAQDDAGEP 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 25/134 (19%)
Homeobox 301..354 CDD:395001 37/52 (71%)
Hoxb2XP_002727852.1 Homeobox 146..198 CDD:278475 37/51 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.