DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and hoxd8

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001135589.1 Gene:hoxd8 / 100216142 XenbaseID:XB-GENE-920113 Length:231 Species:Xenopus tropicalis


Alignment Length:235 Identity:91/235 - (38%)
Similarity:112/235 - (47%) Gaps:44/235 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 HPQQQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSG--------HHMNAQMTLPHHMGHP 204
            :|:.:......:..|.....||       .|..|||...||        ||..   ||| ..|:.
 Frog    10 YPKYKDAINSAFYECPYGQEVG-------SGRAPLVYSGSGSGAPQDYYHHPG---TLP-SPGYQ 63

  Fly   205 QAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAP----PQGMMHQGQGPPQMHQGHPGQH 265
            .|..|.|..|.|.....:.:.....::.......||..|    |...:  |..|..:||..|..|
 Frog    64 PAPCGITCHGDPAKLYGYDHFQRQHIFTTHQEAEPVQYPDCKSPSASI--GADPEHLHQNSPASH 126

  Fly   266 TPPSQNPNSQSSGMPSPLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEI 330
                             ::||||:|.  ...|:||||||:|:|||||||||.||.||||:||||:
 Frog   127 -----------------MFPWMRAQV--APGRRRGRQTYSRFQTLELEKEFLFNPYLTRKRRIEV 172

  Fly   331 AHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSGGEGDE 370
            :|||.|||||:|||||||||||||||.....|.|..||.|
 Frog   173 SHALGLTERQVKIWFQNRRMKWKKENSKDKFPVSSQEGKE 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 42/156 (27%)
Homeobox 301..354 CDD:395001 43/52 (83%)
hoxd8NP_001135589.1 Homeobox 143..196 CDD:365835 43/52 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 133 1.000 Inparanoid score I4475
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.