DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and hoxc3

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_002936696.1 Gene:hoxc3 / 100190990 XenbaseID:XB-GENE-5997986 Length:394 Species:Xenopus tropicalis


Alignment Length:223 Identity:75/223 - (33%)
Similarity:97/223 - (43%) Gaps:71/223 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 QNHHNMGMYQQQ------SGVPPVGAPPQ----GMMHQG------------------QGPPQMHQ 259
            |.::.||...||      ...||...||.    ...|:|                  |.|...:.
 Frog    21 QGNNGMGYLGQQDYPSEDDYQPPFCLPPDTANGSASHKGEHSIKGIDFHLSEVSEQAQQPKSPNS 85

  Fly   260 GHP------------GQHTPP------SQNPNSQSSGMPSPLYPWMRSQFGKCQER--------- 297
            ..|            .:.|.|      |.|..|:.|.||..::|||:......:::         
 Frog    86 DSPLPKSASTQSCTSKKSTGPVSSDVTSPNKKSKGSNMPKQIFPWMKETRQNSKQKKQAPPPADD 150

  Fly   298 -------------KRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRR 349
                         ||.|..||..|.:||||||||||||.|.||:|:|..|.|:||||||||||||
 Frog   151 APAVDSSFLSSASKRARTAYTNSQLVELEKEFHFNRYLCRPRRLEMAKLLNLSERQIKIWFQNRR 215

  Fly   350 MKWKKENKTKGEPGSGGEGDEITPPNSP 377
            ||:||::|.||..||.|   .::|.:||
 Frog   216 MKFKKDHKGKGGGGSPG---GLSPSSSP 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 29/150 (19%)
Homeobox 301..354 CDD:395001 37/52 (71%)
hoxc3XP_002936696.1 Homeobox 167..220 CDD:395001 37/52 (71%)
DUF4074 335..392 CDD:404218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.