DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and cdx1b

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001092232.1 Gene:cdx1b / 100004956 ZFINID:ZDB-GENE-070615-29 Length:255 Species:Danio rerio


Alignment Length:208 Identity:74/208 - (35%)
Similarity:99/208 - (47%) Gaps:25/208 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 SPPLVDQMSGHHMNAQMTL--PHHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVG 241
            :||.....:|:|....:|.  |||     :|.|..:...|...| ....:..|.....|....:|
Zfish    33 APPQYPDFTGYHHVPGITTNDPHH-----SQTGSWNPAYPPPRE-EWTPYGPGSGVSSSSTGQLG 91

  Fly   242 -APPQGMMHQGQGPPQMH-QGHPGQHTPPSQNPNSQSSGMPSPLYPWMR------SQFGKCQERK 298
             :||:....|..|..|.. ....||.:|.:|..|.         |.|||      |..||.:.:.
Zfish    92 FSPPEFSSVQTPGLLQSSINSSVGQLSPNAQRRNP---------YDWMRRSVPPASSGGKTRTKD 147

  Fly   299 RGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPG 363
            :.|..||.:|.||||||||::||:|.||:.|:|.||.|:|||:||||||||.|.:|.||.|.:..
Zfish   148 KYRVVYTDHQRLELEKEFHYSRYITIRRKAELATALSLSERQVKIWFQNRRAKERKINKKKMQQP 212

  Fly   364 SGGEGDEITPPNS 376
            ........|||.|
Zfish   213 QPASTTTPTPPGS 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 34/136 (25%)
Homeobox 301..354 CDD:395001 34/52 (65%)
cdx1bNP_001092232.1 Caudal_act 13..132 CDD:282574 28/113 (25%)
Homeobox 150..202 CDD:278475 34/51 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 98 1.000 Inparanoid score I5016
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.