DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ftz and HB52

DIOPT Version :10

Sequence 1:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_200209.1 Gene:HB52 / 835481 AraportID:AT5G53980 Length:156 Species:Arabidopsis thaliana


Alignment Length:68 Identity:22/68 - (32%)
Similarity:38/68 - (55%) Gaps:3/68 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 KRTRQTYTRYQTLELEKEFHFNRYITRRRRIDIANALSLSERQIKIWFQNRRMKSKKDRTLDSSP 319
            |..::..|:.|..:|||.|..|:.:....::.::|.|.|.:||:.:||||:|.:.|   |.....
plant     9 KNKKKRLTQDQVRQLEKCFTMNKKLEPDLKLQLSNQLGLPQRQVAVWFQNKRARFK---TQSLEV 70

  Fly   320 EHC 322
            :||
plant    71 QHC 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ftzNP_477498.1 FTZ 1..248 CDD:397787
Homeodomain 255..311 CDD:459649 18/55 (33%)
KLF1_2_4_N <321..404 CDD:425360 2/2 (100%)
HB52NP_200209.1 Homeodomain 11..64 CDD:459649 17/52 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.