DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ftz and HB51

DIOPT Version :10

Sequence 1:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_195999.2 Gene:HB51 / 831723 AraportID:AT5G03790 Length:235 Species:Arabidopsis thaliana


Alignment Length:144 Identity:37/144 - (25%)
Similarity:59/144 - (40%) Gaps:28/144 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 SQTQKLKNGDFATPPPTTP--TSLPPLEGISTPP-----QSPGE-KSSSAVSQEINHRIVTA--- 231
            |.|..::|...|..||..|  :|...|...:..|     .:||: ::...:|...:.:|:.|   
plant     4 STTSNVENVRVAFMPPPWPESSSFNSLHSFNFDPYAGNSYTPGDTQTGPVISVPESEKIMNAYRF 68

  Fly   232 PNGAGDFNWSHIEETLASDCKDSKRTRQTYTRYQTLELEKEFHFNRYITRRRRIDIANALSLSER 296
            ||...:.               .|:.|  .|..|...||:.|.....:...|::.::..|.|..|
plant    69 PNNNNEM---------------IKKKR--LTSGQLASLERSFQEEIKLDSDRKVKLSRELGLQPR 116

  Fly   297 QIKIWFQNRRMKSK 310
            ||.:||||||.:.|
plant   117 QIAVWFQNRRARWK 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ftzNP_477498.1 FTZ 1..248 CDD:397787 17/80 (21%)
Homeodomain 255..311 CDD:459649 20/56 (36%)
KLF1_2_4_N <321..404 CDD:425360
HB51NP_195999.2 Homeodomain 77..130 CDD:459649 19/54 (35%)
HALZ 132..166 CDD:460477
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.