| Sequence 1: | NP_477498.1 | Gene: | ftz / 40834 | FlyBaseID: | FBgn0001077 | Length: | 410 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_195716.1 | Gene: | HB16 / 830169 | AraportID: | AT4G40060 | Length: | 294 | Species: | Arabidopsis thaliana |
| Alignment Length: | 46 | Identity: | 18/46 - (39%) |
|---|---|---|---|
| Similarity: | 24/46 - (52%) | Gaps: | 0/46 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 265 QTLELEKEFHFNRYITRRRRIDIANALSLSERQIKIWFQNRRMKSK 310 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ftz | NP_477498.1 | FTZ | 1..248 | CDD:397787 | |
| Homeodomain | 255..311 | CDD:459649 | 18/46 (39%) | ||
| KLF1_2_4_N | <321..404 | CDD:425360 | |||
| HB16 | NP_195716.1 | Homeodomain | 59..112 | CDD:459649 | 17/44 (39%) |
| HALZ | 114..155 | CDD:460477 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||