DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ftz and HB16

DIOPT Version :10

Sequence 1:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_195716.1 Gene:HB16 / 830169 AraportID:AT4G40060 Length:294 Species:Arabidopsis thaliana


Alignment Length:46 Identity:18/46 - (39%)
Similarity:24/46 - (52%) Gaps:0/46 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 QTLELEKEFHFNRYITRRRRIDIANALSLSERQIKIWFQNRRMKSK 310
            |...|||.|.....:...|:..:|..|.|..||:.:||||||.:.|
plant    67 QVKALEKNFELENKLEPERKTKLAQELGLQPRQVAVWFQNRRARWK 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ftzNP_477498.1 FTZ 1..248 CDD:397787
Homeodomain 255..311 CDD:459649 18/46 (39%)
KLF1_2_4_N <321..404 CDD:425360
HB16NP_195716.1 Homeodomain 59..112 CDD:459649 17/44 (39%)
HALZ 114..155 CDD:460477
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.