DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ftz and HB20

DIOPT Version :10

Sequence 1:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_186771.1 Gene:HB20 / 821232 AraportID:AT3G01220 Length:286 Species:Arabidopsis thaliana


Alignment Length:100 Identity:34/100 - (34%)
Similarity:47/100 - (47%) Gaps:11/100 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 HRIVTAPNGAGDFNWSHIEETLASD-----CKDSKRTRQTYTRYQTLELEKEFHFNRYITRRRRI 285
            :|.::..|...|.|.:..||.|:.|     ..:.|:..|.   .|...|||.|.....:...|:|
plant    54 NRSMSLMNVQEDHNQTLDEENLSDDGAHTMLGEKKKRLQL---EQVKALEKSFELGNKLEPERKI 115

  Fly   286 DIANALSLSERQIKIWFQNRRMKSKK---DRTLDS 317
            .:|.||.:..|||.|||||||.:.|.   :|..||
plant   116 QLAKALGMQPRQIAIWFQNRRARWKTRQLERDYDS 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ftzNP_477498.1 FTZ 1..248 CDD:397787 6/21 (29%)
Homeodomain 255..311 CDD:459649 22/55 (40%)
KLF1_2_4_N <321..404 CDD:425360
HB20NP_186771.1 Homeodomain 87..140 CDD:459649 22/55 (40%)
HALZ 142..183 CDD:460477 2/8 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.