DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ftz and nkx2.1

DIOPT Version :10

Sequence 1:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_571851.1 Gene:nkx2.1 / 81883 ZFINID:ZDB-GENE-010404-1 Length:346 Species:Danio rerio


Alignment Length:126 Identity:34/126 - (26%)
Similarity:53/126 - (42%) Gaps:37/126 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 KRTRQTYTRYQTLELEKEFHFNRYITRRRRIDIANALSLSERQIKIWFQNRRMKSK---KDRT-- 314
            ::.|..:::.|..|||:.|...:|::...|..:|:.:.|:..|:||||||.|.|.|   ||:.  
Zfish   160 RKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKVSQ 224

  Fly   315 ------------LDSSPEHCGAGYTAMLP-------PLEATS-TATTGAPSVPVPMYHHHQ 355
                        ...||..      ..:|       |.:.:| |..||..:      ||||
Zfish   225 QQMQQDNGSCQQQQQSPRR------VAVPVLVKDGKPCQGSSHTPNTGVQN------HHHQ 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ftzNP_477498.1 FTZ 1..248 CDD:397787
Homeodomain 255..311 CDD:459649 20/58 (34%)
KLF1_2_4_N <321..404 CDD:425360 10/43 (23%)
nkx2.1NP_571851.1 Homeodomain 160..216 CDD:459649 19/55 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.