DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ftz and HB22

DIOPT Version :10

Sequence 1:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_850266.1 Gene:HB22 / 818233 AraportID:AT2G36610 Length:185 Species:Arabidopsis thaliana


Alignment Length:132 Identity:32/132 - (24%)
Similarity:55/132 - (41%) Gaps:40/132 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 GEKSSSAVS------------------------QEINH-RIVTAPNGAGDFNWSHIEETLASDCK 252
            |..|||.:|                        |:|.| .:....:|.|       ||:.:.:.:
plant    11 GASSSSFISPFYNFDHFSGNQDNRCLGTMMGAQQDILHVPLAMVESGYG-------EESNSFNGQ 68

  Fly   253 DSKRTRQTYTRYQTLE--LEKEFHFN----RYITRRRRIDIANALSLSERQIKIWFQNR--RMKS 309
            :.|:.:.|..:.:.||  .::|...|    ..:...|::.::..|.|..|||.:|||||  |.|:
plant    69 EKKKKKMTSEQLKFLERSFQEEIKLNPDRKMKLNPDRKMKLSKELGLQPRQIAVWFQNRKARWKN 133

  Fly   310 KK 311
            |:
plant   134 KQ 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ftzNP_477498.1 FTZ 1..248 CDD:397787 12/59 (20%)
Homeodomain 255..311 CDD:459649 19/63 (30%)
KLF1_2_4_N <321..404 CDD:425360
HB22NP_850266.1 Homeodomain 70..133 CDD:459649 18/62 (29%)
HALZ 134..167 CDD:460477 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.