DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ftz and lbx2

DIOPT Version :10

Sequence 1:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001007135.1 Gene:lbx2 / 64276 ZFINID:ZDB-GENE-001206-2 Length:257 Species:Danio rerio


Alignment Length:191 Identity:56/191 - (29%)
Similarity:82/191 - (42%) Gaps:50/191 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 SASEDVDYLDVYSPQSQTQKLKNG--DFATPP-----PTTPTSL-----------------PP-- 201
            |:|:|:....|.  ||..::.:.|  |...||     |.||.|:                 ||  
Zfish     3 SSSKDMKAGSVL--QSSGEERRRGPLDQLPPPANSNKPLTPFSIEDILNKPSVKKSVGSLCPPRV 65

  Fly   202 LE----------GISTP--PQSPGEKSSSAVSQEINHRIVTAPNGAGDFNWSHIE---ETLASDC 251
            ||          |||.|  |....|:.:|...:.:...::.|..|.     .||.   :..||  
Zfish    66 LEKVTGSSASRNGISAPSSPLCALEELASKTFKGLEVSVIQAAEGR-----EHINAFGQRQAS-- 123

  Fly   252 KDSKRTRQTYTRYQTLELEKEFHFNRYITRRRRIDIANALSLSERQIKIWFQNRRMKSKKD 312
            |..:::|..:|.:|..||||.|.:.:|::...|..||..|.|:..|:..||||||.|.|:|
Zfish   124 KKRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRD 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ftzNP_477498.1 FTZ 1..248 CDD:397787 29/125 (23%)
Homeodomain 255..311 CDD:459649 22/55 (40%)
KLF1_2_4_N <321..404 CDD:425360
lbx2NP_001007135.1 Required for convergent extension movement and hypaxial myogenesis during gastrulation. Required for the formation of thick and thin myofilaments. Required for myod1 expression in the pectoral fin bud. Required for continuous expression of cxcl12a in the posterior lateral mesoderm at the tail bud stage and in adaxial cells at the 10-somite stage. /evidence=ECO:0000269|PubMed:19216761, ECO:0000269|PubMed:22216300, ECO:0000269|PubMed:22406073 1..46 14/44 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43 13/41 (32%)
Homeodomain 127..183 CDD:459649 22/55 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..257
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.