DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ftz and hoxb6b

DIOPT Version :10

Sequence 1:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_571613.1 Gene:hoxb6b / 58053 ZFINID:ZDB-GENE-000823-7 Length:224 Species:Danio rerio


Alignment Length:58 Identity:47/58 - (81%)
Similarity:55/58 - (94%) Gaps:0/58 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 KRTRQTYTRYQTLELEKEFHFNRYITRRRRIDIANALSLSERQIKIWFQNRRMKSKKD 312
            :|.||||||:||||||||||||||:||||||:|::||.|:||||||||||||||.||:
Zfish   148 RRGRQTYTRFQTLELEKEFHFNRYLTRRRRIEISHALCLTERQIKIWFQNRRMKWKKE 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ftzNP_477498.1 FTZ 1..248 CDD:397787
Homeodomain 255..311 CDD:459649 45/55 (82%)
KLF1_2_4_N <321..404 CDD:425360
hoxb6bNP_571613.1 Antp-type hexapeptide 129..134
Homeodomain 148..204 CDD:459649 45/55 (82%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.