DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ftz and meox2b

DIOPT Version :10

Sequence 1:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_073787071.1 Gene:meox2b / 566969 ZFINID:ZDB-GENE-060503-853 Length:329 Species:Danio rerio


Alignment Length:165 Identity:55/165 - (33%)
Similarity:82/165 - (49%) Gaps:20/165 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 PSYDQEY--VTVPTPSASEDVDYLDVYSPQSQTQKLKNGDFATPPPTTPTSLPPLEGISTPPQSP 212
            ||.:.|.  :.:|.|.|:..    ::....:.:|.:..|:     ||...|.|  .|:|..|...
Zfish   123 PSIESERHGLCLPHPDAAAP----ELCGTGAGSQGMCAGN-----PTLTGSDP--SGVSCVPGEY 176

  Fly   213 GEKSSSAVSQEINHRIVTAPNGAGDFNWSHIEETLASDCKDSKRTRQT-YTRYQTLELEKEFHFN 276
            |.::.|.|..|..     :..|..|.:.|. :.:..||.....|..:| :|:.|..|||.||..:
Zfish   177 GRQNMSPVEPERR-----SSKGKSDSSDSQ-DGSYKSDVSSKPRKERTAFTKEQIRELESEFAHH 235

  Fly   277 RYITRRRRIDIANALSLSERQIKIWFQNRRMKSKK 311
            .|:||.||.:||..|.|:|||:|:||||||||.|:
Zfish   236 NYLTRLRRYEIAVNLDLTERQVKVWFQNRRMKWKR 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ftzNP_477498.1 FTZ 1..248 CDD:397787 22/99 (22%)
Homeodomain 255..311 CDD:459649 30/56 (54%)
KLF1_2_4_N <321..404 CDD:425360
meox2bXP_073787071.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.