DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ftz and MEOX2

DIOPT Version :10

Sequence 1:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_005915.2 Gene:MEOX2 / 4223 HGNCID:7014 Length:304 Species:Homo sapiens


Alignment Length:173 Identity:57/173 - (32%)
Similarity:74/173 - (42%) Gaps:48/173 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 QSQTQKLKNG----DFATPPPTTPTSL--------PPLEGISTPPQSPGEKSSSAVSQEINHRIV 229
            |.|.|.|:..    ..::||.....||        ||..| |:||......||...|        
Human    82 QQQHQALQTNWHLPQMSSPPSAARHSLCLQPDSGGPPELG-SSPPVLCSNSSSLGSS-------- 137

  Fly   230 TAPNGA----GDFNWSHIEETLA---------SDCKDS-------------KRTRQTYTRYQTLE 268
             .|.||    ||:....:....|         ||..||             ::.|..:|:.|..|
Human   138 -TPTGAACAPGDYGRQALSPAEAEKRSGGKRKSDSSDSQEGNYKSEVNSKPRKERTAFTKEQIRE 201

  Fly   269 LEKEFHFNRYITRRRRIDIANALSLSERQIKIWFQNRRMKSKK 311
            ||.||..:.|:||.||.:||..|.|:|||:|:||||||||.|:
Human   202 LEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMKWKR 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ftzNP_477498.1 FTZ 1..248 CDD:397787 22/86 (26%)
Homeodomain 255..311 CDD:459649 29/55 (53%)
KLF1_2_4_N <321..404 CDD:425360
MEOX2NP_005915.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..192 27/119 (23%)
COG5576 160..284 CDD:227863 34/85 (40%)
Homeodomain 188..244 CDD:459649 29/55 (53%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.